PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo2G0124500
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family Dof
Protein Properties Length: 318aa    MW: 33252.8 Da    PI: 8.7963
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo2G0124500genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof120.27.3e-383393262
          zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                    +e+ lkcprCds ntkfCyynnysl+qPr+fCk+CrryWtkGGalrnvP Ggg+rk +ks+
  Spipo2G0124500 33 PEQGLKCPRCDSYNTKFCYYNNYSLTQPRHFCKSCRRYWTKGGALRNVPFGGGSRKTRKSR 93
                    67899***************************************************99976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074788.0E-253091IPR003851Zinc finger, Dof-type
PfamPF027019.6E-333591IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.8633791IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103975IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010052Biological Processguard cell differentiation
GO:0010118Biological Processstomatal movement
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:1902066Biological Processregulation of cell wall pectin metabolic process
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 318 aa     Download sequence    Send to blast
MTPAQAGSVR GPEGSNTSAC GGGGGGGTSP RPPEQGLKCP RCDSYNTKFC YYNNYSLTQP  60
RHFCKSCRRY WTKGGALRNV PFGGGSRKTR KSRSMASLSS STASFRLSAD LHGRAMQEPS  120
FFQLGGYNAY SPVCGTSGGV ASQVLSFGGI SSSTTVGASA APLVVLDCPA PAVSFFNEMG  180
CRGETATTTS EESMGSIHRN LATSIESLSS INQDLHWKLQ QQRLAMFFGG EGHHPTKEGT  240
GGAAVLNALS RHHPPPSLLF SSSRELSAGG ARGGGATGYF LENSTHNTAT VDDNSFAAND  300
WTGTPTWSDV HPFGALR*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7269972e-50KJ726997.1 Zea mays clone pUT3969 C2C2-DOF transcription factor (DOF24) gene, partial cds.
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14037367
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65590.12e-44Dof family protein